Guide 2013/06/02(Sun)21:12 No. 514179 ID: bf54a8
File 137023276213.png - (30.35KB , 1309x873 , cave.png )

the walls were a strange color but it was safe. the people quickly build a simple gathering area/town hall and rest for the day, they need it. tomorrow the real work will begin.


there are 10 adults and three children.
they are able to dig up rock and chop down wood. and build very quickly.

what jobs should be done, and how many should do them?

>>514179
>1 King
>1 WIZARD
>1 Apprentice
>3 Hunters
>3 Gatherers
>1 Farmer
>1 Farmer's Useless Little Assistant

No builders. Build your own homes, you lazy lot!

Step one, build a print shop and start manufacturing capital letters en masse. The poor people are clearly suffering a deficiency.

Uh, what do we have to work with here? What skills / knowledge / capabilities do the adults possess? What's the level of technological and/or magical development?

Regardless, preliminary task are exploring the local area for resources and danger, erecting simple shelter (already seems to have been done) and locating sources of food and water.

Check supplies, particularly food and pickaxes.

>>514182
They cannot do magic! They also do not need nor want a king, all decisions are decided by the group as a whole, DEMOCRACY!

>>514185
The people's current tech level would be about Iron age. and the adults are not specialized. they have been running too long to train in any one task.

>>514186
they have enough food to last perhaps a few days. and they have 2 picks but can make more if they have to.

>>514189
Okay, take two:
>1 King El Presidente
>1 WIZARD Natural Philosopher
>1 Apprentice
>3 Hunters
>3 Gatherers
>1 FarmerMiner
>1 FarmerMINER's Useless Little Assistant

>>514191
couldn't the hunter and gather jobs be bunched into one single job to free up some more workers?

Anyway I say search the surrounding area for anything useful or dangerous and then depending on what we find go from there.

>>514191
I think you're missing the point. We don't need to pick classes, we have a pool of unskilled workers we can split up and assign to tasks as needed. They're all workers.

If we only have two days worth of food, first priority after getting the shelter up is looking for a new food source.

>>514192
Fine, take three:

>1 King El Presidente
>1 WIZARD Natural Philosopher
>1 Apprentice
>3 Hunters
>3 Gatherers
>6 Hunter-Gatherers
>1 FarmerMiner
>1 FarmerMINER's Useless Little Assistant

>>514193
Well how ELSE are we going to divvy up the work load?

Guide 2013/06/02(Sun)22:40 No. 514206 ID: bf54a8
File 137023801327.png - (67.17KB , 1558x1362 , cave2.png )

Two farms are set up, one for trees and one for food.
They also quickly explore the outside and find most of the area is dry with small shrubs, it was risky to reach this mountain across such flat terrain. They rip up some shrubs and add them to the food storage

They also find a stream with some kind of bushes growing near it. The bushes had berries of some sort, those were also added to food storage. They now have about a weeks worth of food without rationing.

The miners cannot dig through the odd colored walls of the cave. Their picks bounce off without scratching it, they dig around.

They can make stone walls but not stone roofs, the meeting area currently is simply a stone floor.

Fortify the opening in the oddly-colored wall- set up a checkpoint of some sort that can be secured in case of enemy attack. Also, attempt to obscure the entrance on the outside cliff face.

So. Who are we hiding from?

any fish in that river? Could be helpful if there are. might help if you also build some kind of storage space to put your food to keep it from spoiling if you can and maybe some simple shelters like tents or something to have the villagers rest in or to take shelter in incase the weather takes a turn for the worst.

>>514208
They are in a cave. The odds walls completely encase them on all sides, at least they think so, it's too dark to see the roof. The need for shelter is more a need for privacy. While they can deal with sleeping all together they would much prefer having their own places.

Besides, what would they make the tents out of?

>>514210
if they are in a cave with no opening on the top then how the hell are there farms getting any sunlight for the crops?

if they don't have to fear the wither yet then save the shelters for later (just really meant something quick and easy to build like a tent)

Now that capital letters are in good supply, build a defensible checkpoint at the entrance to the odd colored area and then start making cushy homes for everyone!

Guide 2013/06/02(Sun)23:44 No. 514213 ID: bf54a8
File 137024189043.png - (68.33KB , 1558x1362 , cave3.png )

Their crops simply don't need light to grow. They aren't sure why, but they are thankful that it is the case.

They construct a sort of ramp and load it with rounded stones. If they have to, the stones can be released and roll down to block up the entrance. They also pile stones to obscure the outer entrance, they sorta succeed.

sadly the river is free of fish.

they pave out three areas for housing.

>>514213
No fish, huh? Any other sources of meat?

>>514213
Alright, we have a new plan: DAM THE RIVER. The resulting flooding will attract fish!

well damming the river isn't the best idea, creating canals or aquaducts so we have fresh water at our home is a good idea.

don't dam the river. we need it to make a moat eventually.

gather grass from around the river and dry it for beds. beds are important.

Guide 2013/06/03(Mon)08:41 No. 514255 ID: bf54a8
File 137027408029.png - (68.79KB , 1558x1362 , cave4.png )

The people will take meat if they can find it, but do not need it.

They make two canals so that the area the grass can grow in increases, and gather some of it.

The three houses have finished with walls. The people enjoy them.

One of the children is almost of age, their hands are large. The ritual of growth must be done tomorrow.

If the ritual is needed then it is needed. Do it.

Other then that We should expand the canals and start seeing if this mountain has any ore to mine. We'll need metal for weapons should those who chased us find us once more.

>>514262
Canals ans mining sound good.

I think they should also try digging downwards at some point in the strange cave, to investigate more of it.

1/2 Guide 2013/06/03(Mon)10:57 No. 514287 ID: bf54a8
File 137028225950.png - (70.55KB , 1558x1362 , cave5.png )

The canals are extended, the grass grows quickly following the water.

Another house is built and more rock is dug up, their supply of stone is good.

The food plants are almost ripe.

2/2 Guide 2013/06/03(Mon)11:01 No. 514290 ID: bf54a8
File 137028251178.png - (42.01KB , 1115x895 , growth.png )

The Sphere of Light is brought out and hung up so that the elder can see what they are doing better. The child lays down near it. The elder cuts a large circle in the child's rock shell so they can leave it, grow larger, and grow a new adult sized shell.

Guide 2013/06/03(Mon)14:22 No. 514333 ID: bf54a8
File 137029454259.png - (74.36KB , 1558x1362 , cave6.png )

was told i didn't have much to suggest for

The new adult rests for the day to grow their new shell. The old discarded one is used to make a simple life crucible. With it the people can now begin to reproduce. Doing so will render two adults useless for working for a week. Should they create a new person?

The food plants are also fully grown, they can give the current population about a day's worth of food each or be divided into 4 seeds each. how many should become food and how many should be replanted?

The trees also are big enough to be harvested, but barely. They can provide one useful piece of wood each at this stage of growth, as well as a single seed. Should any be cut down?

Yes, we have food and water and shelter We can start workign on the new generation.

Otherwise continue on what we have been doing. Only stop if something unexpected comes up.

The food plants should be split so we have several days worth of food as well as enough seeds to grow at least the same amount of plants.

Harvest the trees. Plant the seeds to replace them. Later on we probably want to let them grow longer but right now we need material more now then more material later.

Replant as much as possible without putting yourselves at risk of famine before the next crop becomes ready. Leave the trees for now, as we're not urgently in need of wood, and we want to wait for multiple seeds per tree so that we can get exponential growth of tree farms.

Guide 2013/06/03(Mon)23:23 No. 514432 ID: bf54a8
File 137032698519.png - (78.25KB , 1558x1362 , cave9.png )

Three days have passed.

One tree was cut down and replanted, it's wood used to make a basic supporting structure for shelves in a food store room.

The food plants are growing nicely as well as the trees.

Canals increased some more, the grass as grown along it and more bushes have grown as well. They have yet to grow any fruits.

Some more shrubs have been pulled up to supplement the food store. Of which there is 5 days worth at present.

Now to the event that needs to be brought to your attention. A second tribe of People have appeared and ask to stay in your cave for two days before moving on. There are six of them. Do you let them stay?

(because there are now non-direct control creatures in the area your tribe have been marked in blue, their tribe in purple)


Resources:
30 x stone
65 x food
0 x wood

Structures:
6 basic house
1 flat gathering area
1 food store
1 door blocking device

Special:
Simple crucible of life(full)
Sphere of light (4/5)

Do they want any food? Do they have anything to trade?

>>514441
Yes they require food, and all they have to trade is an unknown seed they obtained from another tribe.

Take 'em in! Seeds are great and we're not in immediate danger of starvation.

Also keep extending the canals. Eventually we can hopefully run a water supply right into the cave for convenience.

sure.

See if we can't convince any of the wanderers to stay. We have lots of room and more hands could be useful.

Also see if you can convince them to help out during their stay.

Guide 2013/06/04(Tue)10:12 No. 514508 ID: bf54a8
File 137036594788.png - (78.10KB , 1558x1362 , cave10.png )

>>514476
None are willing to stay, they are a tribe, they stay together, that is the way of The people.

>>514483
They do help a little. But there is not much they can help with, the current group of people have gotten good at their jobs.

The seed they brought grows into some sort of red plant with two brighter red bulbs, the farmer has no idea what it could be.

The other tribe mostly spends the day wandering around your cave looking at things. They seem... antsy.


30 > 35 stone
65 > 50 food
Sphere of light 4/5 > charged

That is... suspicious. Do we have anything that can be made into weapons?

>>514514
The people can use pickaxes as weapons, or axes. They can make spears and arrows, but those were kept for hunting purposes not combat.

>>514508
Use them as manual labor to cut rocks into bricks and mix gravel into mortar, in preparation to block up the entrance (pr build fortifications if invaders are spotted.

Suggestion 2013/06/05(Wed)00:31 No. 514632 ID: 01531c
File 137041747174.png - (5.69KB , 194x131 , Untitled.png )

>>514508
The seed they brought grows into some sort of red plant with two brighter red bulbs, the farmer has no idea what it could be.

I made a depiction of a ground-crawling plant with fruits that grown from small stems but sit on the ground when ripe. Is it accurate?

Hmm I wish we had more of us around. Set 3 of us on watch armed with the best of the tools. The rest should focus on preparing to block the cave mouth and creating a tunnel towards the river northeast as an escape route.

Quick question was it known that there are traitors amongst the people?

Guide 2013/06/05(Wed)00:43 No. 514636 ID: bf54a8
File 137041820846.png - (5.11KB , 194x131 , red plant.png )

>>514632
oh uh, was not expecting this. uhh...

<more like this

>>514633
on watch where?
inside the main cave? the tunnel? outside?

it looks yummy. devour it.

>>514633
The people do not sacrifice eachother to the enemy... Though they may leave an already dead person out in the open and hope it distracts them.

>>514646
even if it is another kind of food plant it would be incredibly un-ripe, it was only planted this morning and how long it takes to reach full size is unknown.

>>514649
>The people do not sacrifice eachother to the enemy... Though they may leave an already dead person out in the open and hope it distracts them.
"The enemy"? Whats that?

Guide 2013/06/05(Wed)15:16 No. 514720 ID: bf54a8
File 137047057886.png - (39.04KB , 1347x902 , enemy.png )

>>514670
A species of giant animal plant hybrid... things. They don't move at night but that does not matter, their hides cannot be pierced, even by an ancient steel blade. So they are unstoppable during the day and un-killable at night. Thus the people hide, the enemy too large to enter the caves.

you'll find a way... eventually. let's just focus on surviving for now. keep on raising the bulby plants.

mental note: do not enlarge that cave entrance. like, ever.

Guide 2013/06/06(Thu)02:23 No. 514800 ID: bf54a8
File 137051062312.png - (79.41KB , 1558x1362 , cave11.png )

The second batch of food plants are fully grown! 1 plant is worth 12 food or 4 seeds for new plants. One food per person per day is needed. Confirmed growth time is 5 days.

Two trees are at growth stage 2. They will be worth 3 wood and 2 seeds. Another tree is at stage one again. Which trees should be chopped down, if any?

The canals have hit a snag, the dirt is harder the further from the river they go. At first it was ignorable but it is now effecting their ability to dig through it.

Working together the people and the other tribe build a drop stone over the cave entrance, when a stabilizing pole is pulled the stone drops snugly into the cave entrance, preventing anything from getting in, it will take some time to reset and allow passage back out though.

The other tribe will be leaving in the morning.

50>45 food
35>30 stone

So we have 8 plants, Bare minimum needed to feed everyone for 5 days is 4 and 1/5th plants. If we can't work in fractions then go ahead with 5 plants. That means we are planting 12 seeds. Which is a 4 plant growth over last crop. That is Acceptable.

For the trees chop down both of the growth 2 trees. Plant all of the seeds.

Good job on the cave blocker. That will be very useful if the enemy comes by.

As for the canals we are probably going to need better tools. Abandon the project for now and set those who were working it on prospecting the mountain for ore.

Question. What buildings can we build with our current materials and knowledge?

As for the leaving tribe wish them luck on their journey. Perhaps gift them some excess food.

>>514801
>What buildings can we build with our current materials and knowledge?
"They can make stone walls but not stone roofs, the meeting area currently is simply a stone floor."

>>514814
I was thinking more specific. A forge or smelter perhaps? workshops for shaping stone and wood? lumber mills?

a weapons workshop would be nice. these guys look like they might be really good with throwing axes for some reason.

Guide 2013/06/06(Thu)17:31 No. 514874 ID: bf54a8
File 137056505996.png - (42.68KB , 1347x902 , amurdermostfoul.png )

in the morning, when the people go into the food storage room to get a gift, they discover something.

Get everyone in one place, set guards from trusted tribe members, check if the pick came from your stock

is that one of theirs? get their leader.

1/2 Guide 2013/06/07(Fri)19:10 No. 515126 ID: bf54a8
File 137065742789.png - (37.81KB , 1347x902 , deathsight.png )

everyone scatter to investigate except for their lover, they are not dead yet, but dying slowly, by itself a wound like this could still be healed, but they were weakened from the body mass sacrificed to reproduce. all that is left is to go into the li-

"This is strange, all tales from those that nearly die describe being surrounded by a impossibly bright light that pulls at their very being, i see what may be the light they describe, it pulls at me from the door in the wall. But it is weak, muted. I can see the soul of my love and my child, burning brightly. The earthen walls of the room and floor are dark and muted. Yet the large wall of the cave is still colorful, perhaps even more so now. Lines moving upward straight and in a spiral. What do they lead to?" i look up

2/2 Guide 2013/06/07(Fri)19:16 No. 515131 ID: bf54a8
File 137065777137.png - (66.51KB , 1330x892 , theroof.png )

"What is that? A weaker light, it has a similar call as the white one but... it's more asking then a demanding, a 'please join with me' rather then 'you must join with me'. I feel the hand of our lost creators in this. how? i do not know. what should i do?"

If you wish to stay with your love and child do not go in the Light. It will be hard. And painful. But the decision is yours and yours alone.

>>515131
This seems like something important. You should find out what it is.

Guys, he's not surviving this. Go into the light that's asking.

1/7 Suggestion 2013/06/08(Sat)01:53 No. 515216 ID: bf54a8
File 137068160562.png - (41.76KB , 1347x902 , core.png )

"i follow the soft light into the roof of the great cave. I move through the crystal shell and-"

'POWER SURGE DETECTED'

"who said that?"

'SCANNING'

"what?"

'CORE INSTALLED, RUNNING START UP'

"starting what?"

'AWAKENING'

"awakening? what could th- i feel a itching sensation, which is odd since i am dead, i-"

Guide 2013/06/08(Sat)01:54 No. 515217 ID: bf54a8
File 137068167688.png - (70.43KB , 1476x897 , mountain.png )

"I can feel it, all around me. Something greater then myself. if only i could-"

MOVE

Guide 2013/06/08(Sat)01:55 No. 515218 ID: bf54a8
File 137068173541.png - (74.99KB , 1476x897 , mountainrumble.png )

"It's working! It's moving! but this rock is in the way."

MOVE!

Guide 2013/06/08(Sat)01:56 No. 515219 ID: bf54a8
File 137068177819.png - (78.18KB , 1476x897 , mountaincrack.png )

"yes, MORE! IT'S WORKING!"

Guide 2013/06/08(Sat)01:56 No. 515220 ID: bf54a8
File 137068181494.png - (82.76KB , 1476x897 , mountaincrack2.png )

"ALMOST THERE, JUST A LITTLE MORE"

6/7 Guide 2013/06/08(Sat)01:58 No. 515221 ID: bf54a8
File 137068193540.png - (78.18KB , 1476x897 , armburst.png )

"YES I CAN FEEL IT, I CAN FIGHT!"

7/7 Guide 2013/06/08(Sat)01:59 No. 515222 ID: bf54a8
File 137068197582.png - (86.53KB , 1476x897 , armcollapse.png )

'WARNING WARNING, CORE POWER CRITICAL, SHUTTING DOWN TO PREVENT DAMAGE'

"what? what does it mean by power criti- ZZZZZZZZZZZ"

Holy shit, we're living in the belly of a giant mech.

Alright eventual plan: find a way to power that sucker.

As for right now we need to find out who killed that guy. Time to put our deerstalker caps on!

>>515223
>Alright eventual plan: find a way to power that sucker.

Souls. Rock people souls.

>>515227
It seems to be powered by the souls that also pilot it though, so we will need to be careful about who dies inside the mech (such as not the murderer).

gather up the visitors and kill them all.

>>515331
No, thats stupid. People with loyalty to their own tribe only won't help up at all... and might even want us dead in return for killing them.

Guide 2013/06/09(Sun)06:49 No. 515573 ID: bf54a8
File 137078574120.png - (81.12KB , 1558x1362 , cave12.png )

This has been a crazy day for the people. the great cave was suddenly bathed in light coming from the ceiling, and there was a quake, then it stopped and the light went away. Luckily nothing collapsed.

The food is harvested and replanted. The trees as well.

A stockpile is built to store materials.

After scrambling around for a while due to the quake the people have pieced together what happened to that one person. It was a simple theft gone wrong. The other tribe took all food in the storage room and struck them simply to keep them quiet. The fact that they died from the hit was an accident, but the people will not trust anyone from that tribe again.

example objects that need wood
upgrade the central area to have walls, they would be too long to be made properly with just stone, takes 2 wood.

water storage. a large supported deep stone bowl for storing water, basic one needs stairs and to be filled manually. 3 wood

bathing area. pop density is small enough that it doesn't matter but once enough dirty people are near each other they will notice the smell. works well with water tower. 3 wood

medium object assembly area. objects larger then hand sized need something to hold them stable while being worked on. this building uses wooden support structures to hold objects stable. 4 wood.

Any building that requires an overhang or a ledge of some kind needs wood.

60 food
40 stone
6 wood.

Oh and on the opposite side of the cave door is what looks like some kind of crystal ladder, but the rungs are large and too close together to grab on to. The bottom most one has a faint red glow.

I think it'd be wiser to use the wood on basic tools and furniture at this point. there isn't much to do with the ladder which probably is a giant power bar.

oh, and use spare workforce on digging around the robot to discover minerals and free it up a bit.

All that stone knocked loose from the arm should be much easier to harvest then carving it out ourselves.

build a medium object assembly area.

Guide 2013/06/09(Sun)23:16 No. 515889 ID: bf54a8
File 137084500460.png - (81.45KB , 1558x1362 , cave13.png )

The red pods have burst open, it appears to be some kind of cave-cotton. It also contained two seeds, one in each pod.

The discovery that they are inside a construct confirms it, the mountain is artificial, there are no ores to find. They wondered why they could not sense any.

The assemblage is completed, it can produce a number of person sized stone objects per day depending on how many people work in it, 1-3 make the same number as people, while 4 people can make 5 objects. chairs, tables, beds, door etc.

What should be done with the cotton?

Tomorrow is the seventh day after the now dead one and the other started growing a child. The new child will be able to come out of the crucible, their body stable, and the parent will be able to go back to work. A new born can be assigned a job goal making them far more effective at it when they grow up at the cost of being weaker in other areas. An estimate of a 50% increase in ability at assigned job but a 25% decrease in ability to do other jobs. Should they be given a goal? If so what job?

food 48
stone 35
wood 2

Plant both seeds. We can use the cotton for various things. Do you think you could manage making a loom so we can turn the cotton into thread and cloth?

However with no ore we are limited to trade for metal tools. Perhaps theres some nearby instead? send out some scouts to explore the nearby area. Maybe at night time so no Enemy can follow.

As for the child there will always be need for woodcraft, put him with the people at the tool shop.

The final two wood can be used for furniture. I also think if anyone else wants to use the Crucible they should feel free to.

plant all of the seeds and start assembling beds.

oh, and I think fishing nets are made out of cotton. so there's a use other than blankets for you, since you people don't seem to wear clothing.

Guide 2013/06/11(Tue)17:22 No. 516329 ID: bf54a8
File 137099653363.png - (82.31KB , 1558x1362 , cave14.png )

Will assume you mean all four people assemble beds together. In which case 5 beds are produced, 15 stone used.

Because the people are out of any direct dangers the time between reports can increase. Ether weekly or monthly (28 days), will still pause and ask if anything important comes up.

Please supply long term plans and how long you want to go between reports.

stone 35 > 25

food 48 > 37

use stone and wood as much as you like, but you should be saving up at least one fourth of the food you produce. plant a lot of seeds so you can harvest a lot of food in the future.

build more housing with proper furniture for all. beds, tables, chairs, torches. build a dining hall and a storage room. build an extra house or two for the future members of the clan, and a water storage and bathing area. and then a brewery.

what do those two blue dots near the entrance represent?

i seriously need another perspective, and an actual amount of time to skip, is this just a week skip or a month skip?

>>516704
"Perspective" with respect to what?
Skip forward 1 month.

>>516705
with respect to elephant guy, does everyone think it's a good plan? don't want to do a skip then someone says "oh man i wanted to build this one thing"

but if you think so then fine.

>>516709
Oh yeah, wasn't reading the other posts closely enough. Nevermind for now.

>>516336
That plan sounds good.

1/4 Guide 2015/02/28(Sat)10:04 No. 627045 ID: bd8b82
File 142514668097.png - (39.72KB , 1347x902 , corelone.png )

You felt their death, you're not sure how you can feel anything in this state, but you did. your spouse is dead, old age finally caught up with them, you were both pretty old, is why you were both first to have a child. both of you living to almost three years old, would have thought a beast would have gotten you before that.

They are coming to you. you have been alone in this ball for who knows how long, you remember what happened when you entered the sphere, you suddenly felt huge, and tried to break free of the mountain, but ran out of energy after only moving the arm.

2/4 Guide 2015/02/28(Sat)10:05 No. 627047 ID: bd8b82
File 142514672927.png - (40.42KB , 1347x902 , coretogether.png )

they're here! wait, something's happening, what is this?

3/4 Guide 2015/02/28(Sat)10:06 No. 627048 ID: bd8b82
File 142514679202.png - (60.63KB , 1347x902 , coretogetherpower.png )

the energy! I, we, are creating energy by simply being togther. now that you know what it is, you can understand it. we are generating enough to... turn on internal sensors? whatever that means, let's do that.

4/4 Guide 2015/02/28(Sat)10:08 No. 627049 ID: bd8b82
File 142514691264.png - (22.87KB , 752x725 , cave15.png )

the village! we can see it.
it's grown quite a bit from when you last seen it. your mate knows what happened since you died. seems most of the ideas panned out at least somewhat. torches were a no go, while the cloth got the shape right there wasn't anything flamable to soak them in. but the rooms were given some modest furnishings and a communal eating area is being made.


must be something you can do to help rather then just sit here staring at it. first let's quantify our power...
let's say we have 10, we are generating roughly 1.1 units per day, internal sensor grid requires about 1 unit per day to run, so we are barely making an energy profit with the sensors on. other options are;

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

REPAIR SOUL NET - 20 energy, a burst of power into the soul net will seal the gaps that opened over the years of disuse.

MOVE RIGHT ARM - 5 energy, that is a lot of power for such a simple thing, but it IS a big arm.

FREE LEFT ARM - 10 energy, moving that much rock isn't easy.

FREE HEAD- 20 energy, both arms must be already free. (so this thing DOES have a head.)

SHUT DOWN- turn off active equipment to charge power

anything else? what's thi-

ERROR, SECONDARY POWER CORE OFFLINE, MAXIMUM ENERGY CAPACITY IN PRIMARY CORE NOT HIGH ENOUGH TO DELEGATE POWER TO SECONDARY CORE

ow.

>>627049
"Repair soul net" sounds like it might help our power situation somewhat. Let's make that our first priority.

>>627054
Shut down internal sensor during the day.

Wait, would repairing the soul net cause problems for the village? Don't want to accidentally seal the entrance with unbreakable hullmetal or something.

Can internal lights be toggled quickly enough to establish communication with the survivors?

Does the right arm have enough range of motion to touch the point where the river hits the soil, and do you have a written language? If so, move right arm. Specifically, gouge a new canal system into the dirt with one finger, spelling out "death is not the end for us."

>>627104
hmmm... no, that is specifically a door, not a broken gap, you think it can be open and closed, but for some reason you can't do that right now.

second question, also no, while the lights can be toggled quickly, they take a few seconds to shut down after being turned on, seems they have a capacitor system so they don't flicker if the power stream is unsteady. you suppose you could have long dots, and REALLY long dashes. but that would be incredibly inefficient and you would probably use all your power to just say one word. but a good idea none the less!

the arm cannot reach where the water and dirt meet, it can reach where the water is coming from, and can just barely cover the entrance hole in the mountain with it's palm if it wanted to, mostly because there is still a lot of mountain in the way that the arm would need to bend around or break through first to get a better reach.

luck is with you on this one, reading and writing are one of the pre-programed skills, so they would have been able to read notes or instructions left by the makers for tasks and to reply to them if need be. unfortunately none of you have had any reason to practice it and you are blind to the outside, when controlling the arm it feels just like your own, and you do not think you can write accurately in absolute darkness.

I think the best option would be to repair the soul net. Right now that means conserving power.

If its possible I suggest only keeping the sensors active for 5 second bursts every 30 minutes, that will still give you a picture of what is going on and hopefully help save up enough energy within 2 days.

If something happens in the two days that needs our attention we can decide then whether to change priories and use our arm or something.

Err, 10 days not 2.

1/2 Guide 2015/03/02(Mon)07:40 No. 627397 ID: bd8b82
File 142531081262.png - (22.73KB , 752x725 , cave16.png )

not much happens during the ten days of mostly charging. the dining hall is finished, and looks like one of the big trees was finally cut down. three more children have been created. your mate's body was turned into a higher quality life crucible, and a couple that were waiting are given the honor of creating the next elder. was pretty close this time, the elder is already 8 years old, wasn't sure we could get a new one before they died.

anyway,
ENERGY BURST PRIMED, RELEASING IN
3
2
1

2/2 Guide 2015/03/02(Mon)07:41 No. 627398 ID: bd8b82
File 142531086424.png - (92.69KB , 1476x897 , soul burst.png )

PSSSSSSHHHHHH

soul net restored. 5 power unused by repair and reintegrated

uhh, thanks disembodied voice. so did that give any new options?

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy, ah there is the door. seems to use different amounts because it can close different ways. can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

oh, and it has indeed increased how much energy profit we make per day, guess it was leaking. are now making 1.5 energy per day, but costs remain the same. to reiterate the previous options:

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM - 5 energy, that is a lot of power for such a simple thing, but it IS a big arm.

FREE LEFT ARM - 10 energy, moving that much rock isn't easy.

FREE HEAD- 20 energy, both arms must be already free. (so this thing DOES have a head.)

SHUT DOWN- turn off active equipment to charge power

I say launch the soul net.

>>627404
At?

I don't suppose there are some of the Enemy around? We could see if the Soul Net can be used as a weapon!

Otherwise if we need to target something specific we run into the problem of not actually knowing what is around to target. We never did any scouting that I can recall.

>>627412
the problem is more that, even if one of the Enemy WAS around, we wouldn't be able to see it. the head, and presumably the eyes on it are under several tons of rocks.

(external view is simply to you, the suggesters, what is happening better. the souls within the crystal cannot really see that)

Alright, then if we can't really see anything to target using the Soul Net isn't in the cards right now.

Lets save up for freeing both the arm and the head. Same as before. Keep an eye on things by blinking the internal sensors on every once a while.

What do elders do?

Guide 2015/03/02(Mon)11:36 No. 627419 ID: bd8b82
File 142532499032.png - (27.19KB , 1121x930 , the elder.png )

the elder's main job is to be the voice of wisdom. externally they appear just the same as the other members of the tribe, but internally they are rather different. their metabolism is slower, allowing them to live an average of 10 years rather then the 2 of the others, it also means they have less frantic energy, allowing them to sit still and think things through better. as well as handling things that require more precision, such as helping the children get out of their shells when they outgrow them. finally they remember the old stories, of where we came from, of the makers, and the sacrifices made so we few could escape the enemy.

How much do we know about the surrounding terrain? Are there any other landmarks within a half-day's travel? We've potentially got a very strong defensive position here, and growth seems to be proceeding, so it's time to think about outposts. Heliograph towers for early warning, burrows for short-term shelter. Even a fairly simple string of resupply bases can make it vastly easier and safer to travel long distances quickly, which reopens the possibility of a serious search for ore.

Might also make sense to have more than one elder. Two would be enough for redundancy, but three is more politically stable.

Try turning the interior lights on and leaving them on for one full day, right after the next batch of food crops is planted. Mostly to see just how much growth accelerates. After that, don't do anything exciting with power for a while, just keep periodically checking internal sensors until the primary core is charged to capacity or there's some sort of crisis that would benefit from miraculous intervention.

Maybe also use the lights during every 10th sensor check and any off-schedule sensor use, so the people have a clue when their ancestors are watching?

1/2 Guide 2015/03/04(Wed)15:36 No. 627775 ID: bd8b82
File 142551219082.png - (22.16KB , 752x725 , cave17.png )

>>627455
(i must not have made it clear enough, but we have switched tracks and are now in direct control on only those in the core, and by extension the robot. but those outside need an indirect method. still you have some questions that can be answered)

the immediate area is just dry plains all around, the scraggly bushes the only thing around. at a full run a villager could probably reach where the forest to the south begins in half a day. is a mountain range to the west, but too far to reach in even a whole day. think the ocean is to the east. not sure what is north.

keeping only a single elder is not just because we never had time to make more or don't want them, but because it's dangerous to make more. the elder is far less able to run extended distances, one story they tell is that when we first started running, when the Enemy first emerged, the tribes were actually mostly those of the elder's build, we call them Joggers now, 50 of them and only 10 of us, the Runners. but every time the enemy found our hiding place many of them died. but with we runners able to make a clean getaway. the pattern repeated in the other groups as well. many simply stopped having any, we carry the elder from place to place, passing them around as we each get tired. to have more would be impossible to carry.
-------------------

after five days the food plants are harvested and planted anew, as well as the other two giant trees being cut down. lights are turned on after the replanting is finished. for a while the people appeared to be frightened but the elder calmed things down. they bring the sphere of light out and turn it on to compare it's light to yours. when it turns on you can easily detect it is made of the same crystal as the one you are residing in, as well as containing a pair of souls. they seem to search the walls of the cave intently, if you had to guess they are looking for a switch like the one on the sphere on light. the couple creating the new elder are too entranced to notice.

after the day is over the lights are shut off, you estimate that if the lights were on all the time the plants would grow about 25% faster. meaning food plants would grow in roughly 4 days instead of 5.

--------------------

2 days later the new child that will become the elder is done growing. their parents have just enough time to say they love them before the elder leads the child away and then they stop fighting it and fall over dead from exhaustion. they were relatively old at 2 and a half, and creating a new elder takes a lot of energy. looks like you are gonna have new roommates.

2/2 Guide 2015/03/04(Wed)15:37 No. 627776 ID: bd8b82
File 142551227710.png - (79.34KB , 1347x902 , corepowerup.png )

hello!
what, who said?
i did. it's hard to tell who you are, or where i am.
you are in the crystal on the roof, i suppose you didn't see it because you were creating the new elder, we are the ones the created the first child in this cave, as well as the one that was killed in the food storage room.
oh, i see, i think.
i will explain. (the new souls are told where they are and what is happening)
that's amazing.
yes, but it also seems your arrival has changed things, since you have delivered an influx of energy.

current power level 30.5/40
:new option available:

Repair Holographic Communications System- 40 energy, wow a... what is a holographic communications system? the holographic communications system allows communication between the souls within the power core and the current occupants of the live-dome via projecting words into the air. currently damaged from an unknown number of years of disuse, energy requirement is to activate repair mechanisms

what are you? i am the information system, i answer direct questions about the MK3 Combat City as well as report changes to it's status.

(other available options)

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy, ah there is the door. seems to use different amounts because it can close different ways. can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM - 5 energy, that is a lot of power for such a simple thing, but it IS a big arm.

FREE LEFT ARM - 10 energy, moving that much rock isn't easy.

FREE HEAD- 20 energy, both arms must be already free.

SHUT DOWN- turn off active equipment to charge power

>>627776
I say move the other arm. Moving the first one unlocked something, maybe moving the second will do something too? Plus if the second is out, we can expose the head and then we'll have a good defense system active.

I agree, time to free the other arm.

Arm is cool, but secondary. We need to explain to these people just how much their strategic situation has improved. Shut everything down until fully charged and then initiate repairs on the holographic comm system.

Guide 2015/03/05(Thu)13:14 No. 627866 ID: bd8b82
File 142559006151.png - (93.52KB , 1476x897 , arm2.png )

left arm online, let's get it free! ...CRACK
WARNING: FINGER DAMAGED. scanning for cause. likely cause found, finger was at odd angle before moving. intense forces involved in shifting arm free from rock resulted in joint snapping. soul net maintaining structural integrity, estimating repair cost.......

cost estimated, damage not as bad as it first appeared, soul net prevented full separation. once bent back into position it should only take... 20 energy to stabilize, and a further 20 to restore mobility

okay that's good, but in the mean time, OW WHY DOES THIS HURT SO MUCH?! i/we never even had fingers before!

>>627866
Fuck. Spend the 20 to stabilize it. Leave mobility for later.

Monitor the reaction of the village to the event, for now... We need a little more information to decide what to do next.

Yeah, stabilize the finger. Also... where is that water coming from?

Guide 2015/03/07(Sat)20:27 No. 628124 ID: bd8b82
File 142578884668.png - (22.00KB , 752x725 , cave17-2.png )

finger stabalized
WHEW, that feels better.
turning on sensors...

hmmm, seems they have called a meeting over it. from body language you think they are having a calm discussion.

>where is that water coming from?

Relevant data found. when the MK3 Combat City was sealed within the mountain, a small autonomous digging machine was set to drill to the aquifer so that any inhabitants of the live-dome had access to water.

Are there any more of those drilling machines? Or can we contact the one that was sent to the aquifer?

If not continue to build energy, we're gonna need to repair that finger to get at the head.

>>628124
Well they're not freaking out about it so next uncover the head. Then we'll have defenses all set up and we can establish communications as the next priority.

Guide 2015/03/11(Wed)23:11 No. 628791 ID: bd8b82
File 142614066533.png - (22.30KB , 752x725 , cave18.png )

>Are there any more of those drilling machines?

unknown.

Or can we contact the one that was sent to the aquifer?

theoretically possible, if it reached the aquifer relatively quickly it would have shut down without expending too much energy. external communication systems would need to be restored before attempt can be made.

--------------

it's been seven days, energy level is at 20.8, should we restore the finger or continue charging? charge rate when shut down is 3 per day.

status of the village. the last pair are in the middle of creating a child. a use for all that cloth seems to have been found in the form of simple privacy curtains to go on the entrances to their rooms.

Repair the finger, then continue charging.

>>628791
Charge a little more. I think we need to have a small amount of backup energy in case we need to shut the door in a hurry.

Keep a reserve of at least 5, in case the door needs to be slammed or somebody dies outside.

Guide 2015/03/16(Mon)20:28 No. 629510 ID: bd8b82
File 142656292130.png - (93.05KB , 1476x897 , arm2healed.png )

2 days later

finger fully restored
thanks, i figured that

nothing of interest happened in the village.

options
LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy, ah there is the door. seems to use different amounts because it can close different ways. can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM - 5 energy, that is a lot of power for such a simple thing, but it IS a big arm.

FREE LEFT ARM - 10 energy, moving that much rock isn't easy.

FREE HEAD- 20 energy, both arms must be already free.

SHUT DOWN- turn off active equipment to charge power

Repair Holographic Communications System- 40 energy. the holographic communications system allows communication between the souls within the power core and the current occupants of the live-dome.

(was trying to think of anything i could do but had nothing, so just a really lazy update so i can move on)

>>629510
May as well free your head.

>>629554
Yep. Gonna take like another week of charging, but... nothing else to do really!

Left arm has already been freed, hasn't it? Same cost to move it as the right arm?

>>629593
(whoops, yeah, gotta watch what i copy and paste)

>>629559
I say we save up for the internal comms instead. Sure it takes twice as long but then we can actually do stuff.

>>629652
Reason to get the head first is then we can use the Soul Net to get more energy faster, instead of waiting for weeks at a time.

>>629658
Doesn't that only do anything if one of the People dies outside the golem?

...but then that makes it important to have it ready in case that happens. Unless souls can persist outside and wait for us to catch them? Hey info system guy, does that work?

Guide 2015/03/18(Wed)02:06 No. 629761 ID: bd8b82
File 142666958144.png - (23.18KB , 752x725 , cave19-danger.png )

4 days later

power level 18.8

blinking internal sens- OH HELL WHAT IS THAT?!

>Unless souls can persist outside and wait for us to catch them? Hey info system guy, does that work?

how souls work is well docume-

NOT NOW!!


LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy, ah there is the door. seems to use different amounts because it can close different ways. can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT/left ARM - 5 energy each, that is a lot of power for such a simple thing, but it IS a big arm.

FREE HEAD- 20 energy, both arms must be already free.

SHUT DOWN- turn off active equipment to charge power

Repair Holographic Communications System- 40 energy. the holographic communications system allows communication between the souls within the power core and the current occupants of the live-dome.

Oh god.
SLAM THAT DOOR!

>>629762
shut down fast!

Yup, blow 10 energy on slamming the door. Also launch the Soul Net to right in front of the mountain. Lets see if this thing can be used as a weapon.

It'd take most of our energy, but if the door doesn't work the Soul Net might.

1/6 Guide 2015/03/18(Wed)13:58 No. 629799 ID: bd8b82
File 142671232854.png - (23.56KB , 752x725 , SHRIP.png )

DOOR SLAMMED!
launching soul net... NOW!
SHRIIIIIIIIIIIIP
no contact! soul net failed to hit target!
SKREEEEEEEEEEEE
how are we hearing that?!
external audio sensors are picking it up despite being buried, it must be incredibly loud

2/6 Guide 2015/03/18(Wed)14:00 No. 629800 ID: bd8b82
File 142671240695.png - (23.67KB , 752x725 , souldetect.png )

Souls detected in the tongue!?
how the hell-

3/6 Guide 2015/03/18(Wed)14:01 No. 629801 ID: bd8b82
File 142671247888.png - (91.38KB , 1347x902 , corenewguys.png )

HELPNODON'TKILLMEIDON'TWANNADIEPLEASEITHURTS

AUGH, you two, mate, try to filter their thought noise so I can can keep this thing moving.

POWER SURGE, POWER AT 40!

4/6 Guide 2015/03/18(Wed)14:01 No. 629802 ID: bd8b82
File 142671251138.png - (86.81KB , 1476x897 , openheadstart.png )

freeing the head!

HRNNNNNG

5/6 Guide 2015/03/18(Wed)14:02 No. 629803 ID: bd8b82
File 142671255140.png - (91.38KB , 1476x897 , head freed.png )

head free!

power at 20
EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

turn them on!

6/6 Guide 2015/03/18(Wed)14:03 No. 629805 ID: bd8b82
File 142671262480.png - (46.61KB , 1476x897 , enemycombat.png )

The Enemy!
IT'S WOUNDED!
I CAN KILL IT!

>>629805
Apply fist to enemy.

Then launch soul net iff it releases some souls.
If it only releases the Enemy's soul... actually use the soul net then too, I'm curious if we can communicate with it or something.

>>629805
Catch it, crush it, then as it dies, launch the soul net. Don't waste the net.

Yes, crush it in your hands!

Don't underestimate the enemy.

Move whichever arm can reach, inserting fingers as deep as possible into the beast's eyes. This should simultaneously blind and immobilize, with no possibility of it wriggling free short of tearing it's own skull apart. A single movement also minimizes use of power.

Once it's clear the immediate threat is at an end, re-open the door. Let the people see this gruesome new hope for themselves.

1/5 Guide 2015/03/28(Sat)05:36 No. 631362 ID: bd8b82
File 142754618010.png - (48.95KB , 1476x897 , enemycombat2.png )

GOTCHA! you aren't getting away so easily!

2/5 Guide 2015/03/28(Sat)05:37 No. 631363 ID: bd8b82
File 142754622134.png - (71.83KB , 1476x897 , enemynetted.png )

NET DEPLOYED

SQUISH

3/5 Guide 2015/03/28(Sat)05:37 No. 631364 ID: bd8b82
File 142754625490.png - (72.29KB , 1476x897 , enemysouls.png )

souls detected!

4/5 Guide 2015/03/28(Sat)05:38 No. 631365 ID: bd8b82
File 142754633391.png - (160.75KB , 1347x902 , corenewer.png )

lafuewaguelvghayoiabvwepvyweovbweiabnigtweitagecowegafmiweckryvgtneartgbeacrlaweinlfyacsegsegsegfvewkagf

AHHHHHHH
EVERYONE BE QUIET!
mental protection mode active. thought instability has been detected, input to souls is still uniform but output is now heavily monitored to prevent unwanted power surges, warning, high energy actions will be unavailable.

thank you... the soul net it reporting it still has a soul contained, why wasn't it added?

soul is of a different species then that of pilot, soul mismatch can possibly cause irreparable damage to soul core crystal. it can be safely stored in a secondary core crystal

okay then, do that

place it in which one?

which one?

5/5 Guide 2015/03/28(Sat)05:39 No. 631366 ID: bd8b82
File 142754636490.png - (22.16KB , 1121x930 , coresmap.png )

displaying core map

upper secondaries improve arm motor effeciency, lower improve legs

Upper right arm seems sensible enough to me. We got the kill with it, so it's even kind of poetic, in a mildly cruel sort of way.

Legs would be a bit of a gamble. Could be great, could be useless for a long time.

I'm a bit hesitant to put the Enemy's soul into anything important.

So my vote is for left arm. If it does turn out all good we can just make the left our primary

>>631366

Let's go with the Upper Left arm.

>>631366
Upper secondary, the left one specifically.

Man I hope we can still spend that 40 energy on communication. We might be stuck trying to fix subsystems if not.

1/3 Guide 2015/03/29(Sun)15:34 No. 631611 ID: bd8b82
File 142766846434.png - (23.37KB , 1121x930 , coresmapleftarm.png )

soul inserted, performing diagnostic power up to check usability.

2/3 Guide 2015/03/29(Sun)15:35 No. 631612 ID: bd8b82
File 142766850009.png - (91.46KB , 1476x897 , armgrowth1.png )

*BLOOP BLOOP*

3/3 Guide 2015/03/29(Sun)15:35 No. 631613 ID: bd8b82
File 142766852935.png - (91.81KB , 1476x897 , armgrowth2.png )

*SHING*

checking results.... 100% compatabilty...reason unknown, performing deep scan.... reason found, soul displays extreme desire to follow any and all orders, physical shell most likely contained blocks to prevent enemies from giving orders

updating energy requirements

Current power: 125
power per day: 7.6
warning, due to MPM only 5 energy can be used at once until diactivated, cannot be deacted manually to prevent accidental deactivation.

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy, ah there is the door. seems to use different amounts because it can close different ways. can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM- 5 energy.

MOVE LEFT ARM- 4 energy

STAND UP- 20 energy, push rest of body completely out of the mountain

SHUT DOWN- turn off active equipment to charge power

EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

Repair Holographic Communications System- 40 energy. the holographic communications system allows communication between the souls within the power core and the current occupants of the live-dome.

fix holographic

Alright from now on have internal sensors on at all times. We can handle the power requirement. Have lights on during the daytime, turn it off at night. Let's just focus on infrastructure until we can figure out how to stabilize the soul situation so we can progress further on upgrades.

>>631614
derp
>>631615
This

Hmm, that thing that popped up on our arm. Is it just a visible indicator for the allocated soul? Or does it have a function?

Also, we should open the door now that the threat is gone. Let our people see that the Enemy can be killed and that they don't have to hide still.

>>631621
Yes.

Also, let's see if the new souls have calmed down some after twenty minutes or so. Try to engage them one at a time. If they're still gibbering at that point they might just be insane... Would it be possible to throw out some souls if they do turn out to be unrecoverable? I don't want to do that but it'd be good to know if it's an option.

1/3 Guide 2015/03/29(Sun)19:51 No. 631650 ID: bd8b82
File 142768387467.png - (22.95KB , 1121x930 , armside.png )

>>631620
it doesn't look like much from the front but from the side it looks like this.

2/3 Guide 2015/03/29(Sun)19:51 No. 631652 ID: bd8b82
File 142768389924.png - (23.50KB , 752x725 , dooropens.png )

the door is opened, sensors back online.

they seem to be wary but investigating.

3/3 Guide 2015/03/29(Sun)19:52 No. 631654 ID: bd8b82
File 142768395601.png - (151.64KB , 1121x930 , tri-soul.png )

>>631628
good idea
can we try to calm the other souls?
yes, MPM is designed to prevent overwhelming thought noise, channels can be opened slowly. checking souls... opening communication between stable souls.

h-hello? i-we-i-we..... I am the Antampi family, where are we? who are you?

you are in the soul crystal of the... MK3 combat city, is that right? yes you WERE within the body of a great enemy somehow, do you remember that

yes, we all remember being eaten, and then being completely alone for so long, so so long. but we are together now.

well, can you help calm down everyone else in here? if they are from your tribe then a familiar presence should help.


----TIME PASSES----

MPM downgrading to level 1 due to lack of incoherent screaming, average soul status is now roughly equivalent to hyper ventilating.

MPM system now allows up to 20 energy to be used at once.

Let's stand up and look around. Flash the indoor lights to see if we can warn the village that something is about to happen.

>>631678
Depending how well this thing was designed, standing up could be a terrible idea.

Hey info system guy, does this thing have internal gyros or something or will standing up cause earthquakes?

...Also do you have a name, and if not, can you pick one, and if not, can we give you one?

Hmm, we should work on continuing to calm the souls. Perhaps using external sensors to show them outside and the dead enemy will help? Since they were probably too panicked from when we killed it?

Then explain that they can help us defeat more of the Enemy. Get revenge for their deaths and the deaths of everyone who has died at the tongues of these things.

Power up the internal lights and just leave them on indefinitely, now that we can afford to.

Do NOT attempt to stand up. We've got a defensible position of unparalleled strength here already, and that would probably be the equivalent of a major earthquake for everyone living inside. Then, even assuming no complications similar to the broken finger, they'd have no practical way to get in and out with the door impossibly far off the ground.

Instead, wait for the MPM to shut down fully, then repair the comm system.

1/2 Guide 2016/08/26(Fri)22:40 No. 744657 ID: 3663d3
File 147227643083.png - (24.86KB , 752x725 , moved.png )

----the next day----
the people, using a fair number of logs as rollers, have moved the tongue of the beast to a spot that is somewhat out of the way compared to directly in front of the door.

the great lighting has accelerated the growth of the plants

a great number of ideas about what could have happened are discussed while they work, some were completely off the mark, others fairly close.

2/2 Guide 2016/08/26(Fri)22:41 No. 744658 ID: 3663d3
File 147227649036.png - (153.99KB , 1347x902 , coreblanks.png )

----inside the core----
>>631707
gyro exists but current status is unknown

>>631715
you explain to the souls what is happening and try your best to help them calm down. it helps most of them but three have 'given up the ghost' so to speak and have dissolved their personalities, leaving behind empty soul husks.

MPM system fully deactivated due to all present souls being stable

>>631936
repairing holographic systems...
.
.
repairs completed

Current power: 86.6
power per day: 7.5

INTERNAL SENSORS- 1 energy per day, watch your insides

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy. use different amounts to close different ways. you can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM- 5 energy.

MOVE LEFT ARM- 4 energy

STAND UP- 20 energy, push rest of body completely out of the mountain

SHUT DOWN- turn off active equipment to charge power

EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

HOLOGRAPHIC COMMUNICATION SYSTEM- 5 energy to charge and activate and 5 energy a day to keep on, is an extension of the internal lighting system so that must be on as well. allows you to holographicly display anything you wish to the inhabitants of the live dome, holograms are incorporeal.

REPAIR URANITE OBJECT GROWTH SYSTEM- 50 energy, a system designed to grow super uranite objects from the floor or walls of the live dome for use by the inhabitants, limited by knowledge of construction.

>>744658
Use HOLOGRAPHIC COMMUNICATION SYSTEM to talk to the inhabitants and tell them what's going on.

Guide 2016/08/27(Sat)03:37 No. 744699 ID: 3663d3
File 147229427014.png - (30.44KB , 752x725 , sky writing.png )

okay, you can do this, deep breath... uhhh, metaphorical breath.

hello people within the dome, do not be afraid, i am they that died from the treachery of the cloth tribe.

uhhh, they seem to running to the elder and... the elder is yelling up to the crystal... i can't hear them, why not?
to keep requests to the pilots in an orderly fashion the live-dome inhabitants can only talk to them through the listening port.
and where is that?
right next to the spinal power strip.

okay, lets try this again

please head to the power strip, the light on the side farthest from the entrance, to access the communication device.

ah, seems they are going

prove you are who you say, how did we reach this mountain.

we ran north for a half a day out of the forest to the south, i carried you for 5 kilometers then passed you on, then later for another 5 kilometers.

i see, yes i believe you, but how? you were slain, your shell has been rendered into a crucible and your flesh dissolved.

the light in the ceiling of the cave is a massive soul crystal, i and my mate and the others that have died within the cave are all in here and... the souls from within the enemy.

... please elaborate

it appears that the souls of all those eaten by one of the enemy remain trapped within it, when we slew the beast they too entered the soul crystal. the enemy's soul as well, it is inside a sub crystal and from what i have learned it is not evil, it was being controlled by someone.

you mean the enemy outside is really dead and not some new elaborate ruse?! we need to leave, quickly!

what, why?

remember the story of the maker's final attack?

yes, he smote the first of the enemy with a single strike of his great magic, and gave his final command for us to live. we gathered supplies and when the.... reinforcements... arrived. reinforcements, more will come to find their dead comrade!

oh jeez, oh jeez, what do we DO?!

>>744699
We move the mountain so that reinforcements cannot get to us. Time to Stand Up! Also tell the civvies to hold onto something. Or, wait, is the stuff in the village sturdy enough to survive the combat city lurching around? We might have to repair the URANITE system first.

Discuss with the others and the civs.

We can keep watch for incoming reinforcements with the external sensors. Before moving the mountain, let's take the opportunity to gather more water, and any useful materials which can be scavenged from the beast's corpse. Might also want to think about how to make buildings inside earthquake-resistant.

Guide 2016/08/27(Sat)16:02 No. 744758 ID: 3663d3
File 147233894844.png - (25.17KB , 752x725 , proofing.png )

>>744700
you hash out plans with the people in the dome, they go around reinforcing the buildings to the best of their ability and tie down the crucibles with cloth ropes. they also shore up the water pot and add a lip to the top to help prevent the water from sloshing out.

>>744723
the people stock up on what they can but can't do anything with the beast's corpse, their stone tools worthless against it's tough flesh. and unfortunately earthquake resistant construction techniques are not programmed knowledge because great central city never really had earthquakes, you have a basic idea of the concept and precautions, stay away from things that could fall over and get under something, but that's it.

will the people be okay with us standing up without the gyro?
EXTRAPOLATING.... observations of the people's movements and physical ability leads me to yes with 99.99 repeating percent surety

Current power: 85.4
power per day: 7.5

>>744758
Let's do it. STAND UP!

1/4 Guide 2016/08/27(Sat)19:43 No. 744783 ID: 3663d3
File 147235218191.png - (92.53KB , 1476x897 , crack1.png )

Stand Up

beginning standing sequence

RUMBLERUMBLERUMBLE

2/4 Guide 2016/08/27(Sat)19:43 No. 744784 ID: 3663d3
File 147235220619.png - (95.05KB , 1476x897 , crack2.png )

RUMBLE RUMBLE CRACK RUMBLE CRACK RUMBLE RUMBLE

3/4 Guide 2016/08/27(Sat)19:43 No. 744785 ID: 3663d3
File 147235223505.png - (120.58KB , 1476x1345 , emerged.png )

BOOM
running diagnostic..... no problems detected other then previously queued repair requests

4/4 Guide 2016/08/27(Sat)19:44 No. 744786 ID: 3663d3
File 147235229227.png - (14.16KB , 600x600 , map.png )

okay, which way should we go? we have the the sea to the east, forest to the south, mountains to the west, and unknown to the north.


Current power: 65.4
power per day: 7.5


INTERNAL SENSORS- 1 energy per day, watch your insides

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy. use different amounts to close different ways. you can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM- 5 energy.

MOVE LEFT ARM- 4 energy

WALK- 25 energy per day of solid walking, minimal shaking

JOG- 50 energy per day of solid jogging, WARNING, GYRO SYSTEM UNRESPONSIVE, JOGGING WILL CAUSE LARGE SCALE SHAKING IN THE LIVE DOME EVERY STEP.

RUN- 100 energy per day of solid running, WARNING, GYRO SYSTEM UNRESPONSIVE, RUNNING WILL CAUSE MASSIVE TREMORS IN LIVE DOME EVERY STEP.

EXTEND/RETRACT STAIRS- 10 energy, control the staircase leading from the live dome hatch to the ground.

SHUT DOWN- turn off active equipment to charge power

EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

HOLOGRAPHIC COMMUNICATION SYSTEM- 5 energy to charge and activate and 5 energy a day to keep on, is an extension of the internal lighting system so that must be on as well. allows you to holographicly display anything you wish to the inhabitants of the live dome, holograms are incorporeal.

REPAIR URANITE OBJECT GROWTH SYSTEM- 50 energy, a system designed to grow super uranite objects from the floor or walls of the live dome for use by the inhabitants, limited by knowledge of construction.

>>744785
Curious. Where was the water coming from?

>>744786
We'll want external senses for this I'm thinking. Unless there are some passive sensors that work fine for walking?

What is our objective currently? Anyone who would send further enemies towards the city will be able to follow the city's footsteps. We can't run away. At best we could step into the ocean and live off the fish there for a while, but then we'd need freshwater from somewhere. If we can gather a few week's worth of water from the forest we could then use the ocean waters for shelter, and then try to further repair the city. Maybe we could send out a citizen or two to scout out landmarks for the city to walk to?

>>744794
see
>>628124

How tall are the trees, relative to the city? If there's any chance of stealth, let's start walking that way. If not, up to the mountains.

1/2 Guide 2016/08/28(Sun)19:27 No. 745033 ID: 3663d3
File 147243764865.png - (13.37KB , 600x600 , mapmove.png )

>>744976
>>744794
your perspective may be a little skewed due to not seeing the forest since moving in here, but you are fairly certain none of the trees get past the ankles of this thing. you are also unsure of how to gather large quantities of water from the forest. so the mountains it is, you turn and begin walking walking towards them. even at a walk this thing is faster then you used to be able to run.

2/2 Guide 2016/08/28(Sun)19:28 No. 745034 ID: 3663d3
File 147243772431.png - (25.24KB , 752x725 , shaken.png )

let's see how everyone is doing inside after that... they look okay to me.

Current power: 65.4
power per day: 7.5
daily consumption: 41

ALERT, consumption greater than quadruple generation rate, this does not cause problems in and of itself but reaching 0 while walking could result in falling over due to system shut down being sudden rather then gradual

yeah that sounds bad. what should we turn off? also, do you have any questions for the info system, or the elder?

>>745034
I don't think there's anything we need operational except walking and external senses.

If we were able to escape the 'reinforcements' back in the mists of history at footmobile speeds, and the city's lowest speed is much faster than that, I think we're adequately safe just marching for one day in the direction of the mountains and then stopping to recharge.

1/2 Guide 2016/08/29(Mon)18:04 No. 745233 ID: 3663d3
File 147251904463.png - (14.78KB , 600x600 , mapmove2.png )

>>745062
Current power: 65.4
Power per day: 7.5
Daily consumption: 30

ALERT, consumption greater than quadruple generation rate, this-

Cancel alert. i don't think it will stop bugging us until power generation rises enough.


>>745171

Ah, that was only part of the story. to expand on it while we walk.

Back when we lived with the makers, within their great walled city we were an army. but after the first beast came we made ready to leave. the walkers that worked in the labs, that acted as living recorders for any ideas and insights the men of science had. came out from these labs with many strange and wonderous plant seeds. the first of the cave plants. types of plants that can grow almost anything anywhere. they were handed to the generals. who passed them out. several of each of the strange plants to each group. 20 groups of 20 joggers and 10 runners each. with the rest of the joggers staying to man the wall. the groups were put all around the wall, to appear ready to fight, but to actually be simply waiting for the right moment to leave.

5 beasts came as one, they were wary this time, they knew that one of them was killed here. they would not underestimate the city again. they came in hard and fast. slaming into the walls and knocking them over. eating the warriors as fast as they could. the groups knew it was time to leave. so as one, the ready groups ran. taking only a glance behind to see the walker generals still leading those remaining in a suicidal distraction attack, burying the beasts in pure numbers to hold them at bay long enough for the running groups to get out of sight.

2/2 Guide 2016/08/29(Mon)18:04 No. 745234 ID: 3663d3
File 147251908783.png - (43.96KB , 1300x900 , mountain_start.png )

We are here, at the base of the mountains, that really was quick. only about 6 hours. What should we do, try to go up the mountains? Search for something?

Current power: 59.4
Power per day: 7.5
Daily consumption: 30


INTERNAL SENSORS- 1 energy per day, watch your insides

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy. use different amounts to close different ways. you can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM- 5 energy.

MOVE LEFT ARM- 4 energy

WALK- 25 energy per day of solid walking, minimal shaking

JOG- 50 energy per day of solid jogging, WARNING, GYRO SYSTEM UNRESPONSIVE, JOGGING WILL CAUSE LARGE SCALE SHAKING IN THE LIVE DOME EVERY STEP.

RUN- 100 energy per day of solid running, WARNING, GYRO SYSTEM UNRESPONSIVE, RUNNING WILL CAUSE MASSIVE TREMORS IN LIVE DOME EVERY STEP.

EXTEND/RETRACT STAIRS- 10 energy, control the staircase leading from the live dome hatch to the ground.

SHUT DOWN- turn off active equipment to charge power

EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

HOLOGRAPHIC COMMUNICATION SYSTEM- 5 energy to charge and activate and 5 energy a day to keep on, is an extension of the internal lighting system so that must be on as well. allows you to holographicly display anything you wish to the inhabitants of the live dome, holograms are incorporeal.

REPAIR URANITE OBJECT GROWTH SYSTEM- 50 energy, a system designed to grow super uranite objects from the floor or walls of the live dome for use by the inhabitants, limited by knowledge of construction.

>>745234
Look for mines. With how powerful the city-walker is we could just fucking dig out a bunch of ore by breaking open a mountain. The main problem is prospecting.

Lets hide in the mountains so we aren't clearly visible and stop for now. Pity we don't have a camouflage ability, beyond just covering ourselves with mountain bits.

Once we're settled we should activate stairs and internal lights\communication and ask the people to send out scouts to look for nearby resources that they could use. I bet there are useful ores in the mountains. Maybe even something that can feed us energy beyond waiting for more souls.

1/3 Guide 2016/08/30(Tue)16:49 No. 745355 ID: 3663d3
File 147260096297.png - (22.05KB , 600x600 , mapmove3.png )

Okay, into the mountains a bit is.
Ah, this is difficult to move through while staying upright.
...
...
Hmmm, where would be a good place to stop.. ah ha! *CRUNCH! SCRAPE SCRAPE* if you can't find a good spot to stand, then make one.

2/3 Guide 2016/08/30(Tue)16:49 No. 745356 ID: 3663d3
File 147260098647.png - (69.41KB , 1476x1345 , cliffstop.png )

Shut down walking motors and external sensors
Open the door

3/3 Guide 2016/08/30(Tue)16:50 No. 745357 ID: 3663d3
File 147260103908.png - (25.24KB , 752x725 , stopped.png )

Turn on internal sensors, lights and communication.

*one explanation of plan later*

a group of four are going to go scout around the area

Two are dismantling the rock-slide ramp since the actual door is better

Last two are inspecting the buildings to make sure none were damaged during the walk.

Current power: 49
Power per day: 7.5
Daily consumption: 11

Oh it should help to find an aquifer again.

Are the walker's hands dextrous enough to peel the creature's tongue? Or to slice it apart by making a jagged stone?

Hmm, we're still draining energy. Turn everything off beyond external sensors while we wait for us to get a good hold on the surrounding area. We might need to move again if the Enemy is smart enough to track us to these mountains.

>>745360
Let's trust the scouts to keep an eye on the outside world. Can those living inside communicate with souls in the crystals through the interface panel without internal sensors active? If so, shut EVERYTHING down until petitioned for assistance. If not, internal sensors only.

If the batteries are charged to capacity before anything else goes wrong, repair the Uranite Object Growth System.

Guide 2016/09/01(Thu)14:09 No. 745547 ID: 3663d3
File 147276417666.png - (23.71KB , 752x725 , week.png )

>>745358
how do you propose we get to the aquifer? previous one was breached with a specilized aquifer drilling device. and no, our hands are extremely clumsy... why is that? is it just becuase i never had fingers before?
arm systems have been heavily tuned for combat use they ether use no power or full power, left arm enhancement via secondary core soul insertion has added a power dial of a sorts allowing it to perform less energy intensive actions, thus it can use only 4 energy to move at all while still needing 5 for maximum strnegth output
thanks.
finally no, stone cannot cut beast flesh, steel can't cut beast flesh, the metal of this walker, Uranite i suppose, is the only physical material to have ever harmed a beast.

>>745425
live dome to soul crystal communication system is extremely low energy demand to remain operational
well why isn't there a simple communication system from the crystal back into the dome?
unknown
sigh... fine.
*one last message to the dome inhabitants about when to use the communication system*

full shutdown except for dome communicator
----1 week later----

*beep beep beep* huh what?
you are being contacted on the dome communicator
thanks... ah they have finished scouting around and found several material deposits, iron, copper, tin, and some quartz crystal. they have also found a handful of bauxite stones but no source for them, could be located outside their search radius, which is the average distance a runner can go at full speed in an hour. can any of those be used by the city?
several subsystems make use of several materals other then Uranite, copper and silicon are in component parts for the Uranite object growth system, having extra would allow us to repair the system more effectively instead of shredding those components into atoms and rebuilding them
how do we use them instead of doing that shredding thing?
repair systems will automatically detect excess materials in hands when activated, materials will be capable of being placed into storage compartments once the uranite growth system allows us to make said compartments

Current power: 101.5
Power per day: 7.5

INTERNAL SENSORS- 1 energy per day, watch your insides

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy. use different amounts to close different ways. you can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM- 5 energy.

MOVE LEFT ARM- 4 energy

WALK- 25 energy per day of solid walking, minimal shaking

JOG- 50 energy per day of solid jogging, WARNING, GYRO SYSTEM UNRESPONSIVE, JOGGING WILL CAUSE LARGE SCALE SHAKING IN THE LIVE DOME EVERY STEP.

RUN- 100 energy per day of solid running, WARNING, GYRO SYSTEM UNRESPONSIVE, RUNNING WILL CAUSE MASSIVE TREMORS IN LIVE DOME EVERY STEP.

EXTEND/RETRACT STAIRS- 10 energy, control the staircase leading from the live dome hatch to the ground.

SHUT DOWN- turn off active equipment to charge power

EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

HOLOGRAPHIC COMMUNICATION SYSTEM- 5 energy to charge and activate and 5 energy a day to keep on, is an extension of the internal lighting system so that must be on as well. allows you to holographicly display anything you wish to the inhabitants of the live dome, holograms are incorporeal.

REPAIR URANITE OBJECT GROWTH SYSTEM- 50 energy, a system designed to grow super uranite objects from the floor or walls of the live dome for use by the inhabitants, limited by knowledge of construction. SPECIAL - if silicon and copper are in excess instead requires 25 energy

Lets repair the uranite growth system then.

We've got a reasonable energy reserve for emergencies, so let's turn the interior lights back on, to help build up stocks of food and lumber. Turn on holographic communication just long enough to direct provisioning scouts to gather as much copper and silicon as possible, and maybe make a quick horizon sweep with the external sensors to see if anything has changed beyond scout range, but otherwise try to keep the reserve on an upward trend: 2.5 per day with just the lights, or 1.5 with just lights and internal sensors.

Repair the fabber as soon as enough materials are available to get the price break.

>>745547
Grab some copper for the repair bonus. Grab some iron for civilian use. Copper and tin can make bronze which might be a better starting metal if the civs can't work a bloomery.

1/4 Guide 2016/09/04(Sun)09:19 No. 746032 ID: 3663d3
File 147300596833.png - (47.89KB , 750x750 , copper.png )

>>745549
well we just..

>>745642
that would take a really long time

>>745645
now that i can work with, let's see, said it's over this way... *LOUD ROBOT WALKING*

2/4 Guide 2016/09/04(Sun)09:19 No. 746033 ID: 3663d3
File 147300598911.png - (28.33KB , 750x750 , copper-grab.png )

GRABBING!

3/4 Guide 2016/09/04(Sun)09:20 No. 746034 ID: 3663d3
File 147300600918.png - (15.48KB , 750x750 , coppergone.png )

CRUNCH

4/4 Guide 2016/09/04(Sun)09:20 No. 746035 ID: 3663d3
File 147300603783.png - (23.67KB , 752x725 , storage.png )

and.. repair uranite object growth system
starting repairs... approriate materials located, harvesting....repairs completed

Current power: 66
Power per day: 7.5


new systems connected, uranite growth system main node connecting to several others.

REPAIR POWER ADAPTER - 30 energy, allows other fors of energy to be harvested to supplament primary soul crystal, EFFECIENCY LOW, only relatively high energy outputs will register. material bonus with copper and iron - 10 energy

REPAIR GYRO SYSTEM - 50 energy, the gyro causes the live dome to rotate in such a way that it negates rocking shaking and allows the main chassis to bend and rotate allowing greater mobility, material bonus with iron, carbon, silicon, copper, and gold - 20 energy

REPAIR ATOMIC CONTROLLER - 20 energy, add on to the uranite growth system that allows adding other materials to grown objects. material bonus with copper and silicon

new system activated

URANITE OBJECT GROWTH SYSTEM - X energy, grow anything you can imagine from pure uranite, complex machines can be done so long as it is one material. power refence would be.... 10 energy to grow a slab that is used as a house foundation. you can also 'find and replace' any already made building.


what about pickaxes?
scanning... 5 objects of that shape can be made for 1 energy, where would you like them to grow?
let me think about it....

>>746035
Oh wow we can make a smeltery really easily with this. Maybe even something powerful enough to process sand to get silicon, if we can hook up machines to the city's power source.

I'm not sure pickaxes are a good idea. Manual mining is very slow. How about we skip straight to making weapons from uranite? Spears, swords, shields, chainmail. Also a bunch of tools for various tasks. Can we make guns? If not I suppose someone can go harvest lumber to carve into bows or crossbow limbs. The stiff parts of a crossbow can be made from uranite, though weight concerns are an issue. How lightweight is uranite?

Before anything else we should repair the power adapter.

I actually say go for the pickax creation. We're still primarily relying on people scouting for ore while we build up energy and super-material pickaxes can only help. In fact we should build several different tools for prospecting\extracting means.

>>746189
>power adapter
Oh, yeah, that seems like a good early investment. Then we can put windmills on top of the city or something. Solar panels? Can we make those? Nuclear reactor?

Obviously we should grab some copper and iron to help with the cost.

1/3 Guide 2016/09/05(Mon)03:04 No. 746191 ID: 3663d3
File 147306988493.png - (21.85KB , 750x750 , uraniteformation.png )

>>746190
>>746189
(bear with me for a bit, was working on this for a while)

>>746045
Uranite is formed when raw soul energy is forced out of the ethereal plane into the physical one, this freshly formed uranite is super dense, heavy, heat resistant, and basically indestrutable. this is due to the soul energy confusing the laws of physics and essentially 'maxing out' all the 'settings' on it's properties. it was named uranite due to passing similarties to depleted uranium and a discoverer( Dr. Hawk Rite) that was bad at naming things(self acknowledged). in this fresh phase it is useless for basically anything besides really fancy unbreakable weights. but when more soul energy is sent through it, it's properties can be altered in any way you want, if you have enough energy.

2/3 Guide 2016/09/05(Mon)03:06 No. 746192 ID: 3663d3
File 147307001381.png - (34.86KB , 867x551 , circulate.png )

this leads to how it is used in the mk 3 combat city, overall it has been preset to a balance strength and lightness, unfortunantly being light applies a 'soft cap' on the streagth and durability it can provide without active power circulation. the secondary mini core this 'enemy' as you call it has been placed into acts as an automated energy circulator, causing the left arm to be be lighter and stronger. you could maximize strength to the peak if you actively use main core energy but safety measures are installed to autoadjust the settings of things such as weight to prevent catastrophic failure due to the square cube law doing things like snapping the legs off, current power required to maximize body strength without breaking is....4900 energy an hour.

3/3 Guide 2016/09/05(Mon)03:09 No. 746194 ID: 3663d3
File 147307014408.png - (13.14KB , 958x628 , grown.png )

this finally leads creating other objects. this is done using a collection of nanomachines to gather uranite particles that have been grown and set to being weak enough to be removed by the nanomachines, they then assemble the object in the requested shape, if it is stand alone device it's settings are finalized for use with no circulation and then severed from the main hull. varible setting objects can be made if a soul crystal battery is attached, unfortunantly soul crystal growth systems at this time are unresponsive.

huh, so we can make nearly unbreakable razor pickaxes but they would weigh a ton.

Four pickaxes and some kind of knife or saw. Then, start carving up that tongue.

How about a hollow sheath of uranite for the 'blade' portion of a pickax to reduce weight. If the material is already heavy and really sturdy it doesn't need to be solid. We can just use wood for the handle.

>>746194
Simple solution: Extremely tough and sharp points on the pickaxe, lightweight uranite for the rest of the pick. It's like diamond-tipped tools. The weight can be adjusted to allow for better oomph when swinging the pick, for those who can handle it.

very well then, you feed your ideas into the growth system and they are made. you even have instructions etched into the sides of them.

the people are agreeable towards the new tools, a four person team heads out on a mining expedition while one starts slicing into the beast tongue, incredibly happy to be doing something that involves harming the beast, even if it's already dead.

interesting, it seems that only the outer casing of it is strong, the insides are just as easy to cut as normal flesh.

your child has grown enough they are allowed to work on simple jobs, like they were working towards they are a woodworker and have made a simple plant pot for their room. desire to make things must have come from their creation thought: crineadutistveous. uhhh, let's try that again, creative and industrious. so they like thinking of new things and working. kinda merged the words there the first time since me and my mate of kinda merged in here, without the MPM running we all act mostly in unison.

anyway! do we have anything else to do or should we power down until energy is full or called on?

Current power: 65
Power per day: 7.5

INTERNAL SENSORS- 1 energy per day, watch your insides

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy. use different amounts to close different ways. you can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM- 5 energy.

MOVE LEFT ARM- 4 energy

WALK- 25 energy per day of solid walking, minimal shaking

JOG- 50 energy per day of solid jogging, WARNING, GYRO SYSTEM UNRESPONSIVE, JOGGING WILL CAUSE LARGE SCALE SHAKING IN THE LIVE DOME EVERY STEP.

RUN- 100 energy per day of solid running, WARNING, GYRO SYSTEM UNRESPONSIVE, RUNNING WILL CAUSE MASSIVE TREMORS IN LIVE DOME EVERY STEP.

EXTEND/RETRACT STAIRS- 10 energy, control the staircase leading from the live dome hatch to the ground.

SHUT DOWN- turn off active equipment to charge power

EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

HOLOGRAPHIC COMMUNICATION SYSTEM- 5 energy to charge and activate and 5 energy a day to keep on, is an extension of the internal lighting system so that must be on as well. allows you to holographicly display anything you wish to the inhabitants of the live dome, holograms are incorporeal.

URANITE OBJECT GROWTH SYSTEM - X energy, grow anything you can imagine from pure uranite, complex machines can be done so long as it is one material. power refence would be.... 10 energy to grow a slab that is used as a house foundation. you can also 'find and replace' any already made building.

REPAIR POWER ADAPTER - 30 energy, allows other fors of energy to be harvested to supplament primary soul crystal, EFFECIENCY LOW, only relatively high energy outputs will register. material bonus with copper and iron - 10 energy

REPAIR GYRO SYSTEM - 50 energy, the gyro causes the live dome to rotate in such a way that it negates rocking shaking and allows the main chassis to bend and rotate allowing greater mobility, material bonus with iron, carbon, silicon, copper, and gold - 20 energy

REPAIR ATOMIC CONTROLLER - 20 energy, add on to the uranite growth system that allows adding other materials to grown objects. material bonus with copper and silicon

Let us power down for now. Though I do have a suggestion to start repairing things as we get enough materials to make them cheaper then their base cost. The new pickaxes should make gathering the ore pretty easy to come by.

Priority should go to first the Gyro System, then the Power Converter and then the rest.

Guide 2016/09/09(Fri)04:19 No. 747180 ID: 3663d3
File 147341995635.png - (23.64KB , 752x725 , carving.png )

(forgot image)

Guide 2016/09/13(Tue)08:05 No. 747849 ID: 3663d3
File 147377914294.png - (24.75KB , 752x725 , ores.png )

--1 week passes--

Current power: 117.5
Power per day: 7.5

We have reached enough stores of iron, carbon, silicon, and copper for all three currently repairable objects, unfortunately there has been no gold found. Therefore current energy costs to repair things are as follows:

POWER ADAPTER - 10
ATOMIC CONTROLLER - 10
GYRO SYSTEM - 35

>>747849
Repair the power adapter first. If that doesn't unlock further power-supply-related repair options, and enough materials are still available, go ahead with the other repairs.

>>747871
I'll agree with that.

Guide 2016/09/14(Wed)14:23 No. 747945 ID: 3663d3
File 147388819587.png - (59.34KB , 1476x1345 , gyro.png )

Repair power adapter

repairing... done

... and nothing new unlocked?

affirmative

dang, okay next the atomic controller and the gyro system

repairing .... done. gyro system online.

new systems found

REPAIR COMMUNICATION SYSTEM - 30 energy, satellite communication system, allows access to any orbiting systems as well as any other machines with compatible systems, material bonus - gold and silicon, 10 energy.

REPAIR SOUL CRYSTAL GROWTH SYSTEM - 50 energy, system designed to promote proper formation and growth of soul crystals for any applications. material bonus with - 5 soul husks , 10 energy

REPAIR GRAVITON COLLECTOR - 100 energy, graviton conduction and storage system for use in gravity controller(currently unresponsive). material bonus with - dark matter , 40 energy

... okay what? what is dark matter and how the heck do we get it?

dark matter is a material present but invisible through most of the universe, it can be noticed, and therefor interacted with properly, if extreme gravity is focused into a point within a vacuum... gravity controller system offline presents a catch 22, checking for resolutions.... resolution found, gain dark matter from other still operational uranite facility, checking for *BEEP* communication system offline, cannot request facility location information

argh!


Current power: 62.5
Power per day: 7.5

GYRO SYSTEM - PASSIVE - lower body, live dome, and upper body are now semi-separated allowing greater range of movement without tipping the live dome over and reducing vibrations caused by movement.

POWER ADAPTER - PASSIVE - energy can be gained from other sources, only relatively energetic sources of energy will be usable. for example, a lighting bolt.

INTERNAL SENSORS- 1 energy per day, watch your insides

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy. use different amounts to close different ways. you can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM- 5 energy.

MOVE LEFT ARM- 4 energy

WALK- 25 energy per day of solid walking, minimal shaking

JOG- 50 energy per day of solid jogging, WARNING, GYRO SYSTEM UNRESPONSIVE, JOGGING WILL CAUSE LARGE SCALE SHAKING IN THE LIVE DOME EVERY STEP.

RUN- 100 energy per day of solid running, WARNING, GYRO SYSTEM UNRESPONSIVE, RUNNING WILL CAUSE MASSIVE TREMORS IN LIVE DOME EVERY STEP.

EXTEND/RETRACT STAIRS- 10 energy, control the staircase leading from the live dome hatch to the ground.

SHUT DOWN- turn off active equipment to charge power

EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

HOLOGRAPHIC COMMUNICATION SYSTEM- 5 energy to charge and activate and 5 energy a day to keep on, is an extension of the internal lighting system so that must be on as well. allows you to holographicly display anything you wish to the inhabitants of the live dome, holograms are incorporeal.

OBJECT GROWTH SYSTEM - X energy, grow anything you can imagine from pure uranite, complex machines can be done so long as it is one material. power refence would be.... 10 energy to grow a slab that is used as a house foundation. you can also 'find and replace' any already made building. upgrade allows system to build from other materials if they are on hand.

>>747945
REPAIR COMMUNICATION SYSTEM, with material bonus if we can get it. Then we'll be able to ping satellites and possibly find points of interest to travel to.

>>747945
The "jog" and "run" options say gyros are still unresponsive.

What are soul husks, exactly?

>>748019
I think husks are what we get when we absorb souls but they won't stop freaking out and go brain-dead. We don't have many right now.

1/2 Guide 2016/09/16(Fri)23:13 No. 748244 ID: 3663d3
File 147409281644.png - (12.05KB , 650x461 , sat.png )

communication system repaired, pinging ether channels....
...
...
PING! [i]

hello, you have reached the high orbit scanning satellite: TER-873. please input authorization code

[i] sg;g9lkyfl5RI*EKIgfl*EKo6OP_G

code accepted, it has been 1 1 2 8 3 years since your last ping, MK3-00004. what is the nature of your request?

i require directions to the nearest uranite facility

confirmed ... nearest facility located, colony ship REBECCA is currently on the surface, sending data. will that be all?

can you batch me through to the ship?

confirmed, please be aware that this is not my designated role so only basic information can be sent, kshhhhhh

WHAT?! who, who is this?

greetings, i am the helper AI on board MK3-00004, we are in need of repairs, current order requests dark matter but gravity control system is offline, we desire fuel up from your stores and energy supply if possible

... not much for conversation are you? yeah yeah i got some dark matter, and plenty of juice. just come over and take any docking clamp you want, not like there's a line... are you manned?

affirmative, 00004 is currently crewed by a species with a rating of 3: metal tool creation/use.

very well then, i have added you to the white-list for my perimeter, you may approach, see you later. BEEP

Guide 2016/09/16(Fri)23:14 No. 748245 ID: 3663d3
File 147409287176.png - (22.45KB , 600x600 , mapdirect.png )

map updated, the REBECCA is located east by south east.

Current power: 42.5
Power per day: 7.5

GYRO SYSTEM - PASSIVE - lower body, live dome, and upper body are now semi-separated allowing greater range of movement without tipping the live dome over and reducing vibrations caused by movement.

POWER ADAPTER - PASSIVE - energy can be gained from other sources, only relatively energetic sources of energy will be usable. for example, a lighting bolt.

INTERNAL SENSORS- 1 energy per day, watch your insides

LAUNCH SOUL NET- 5 energy, soul net is released from body to catch souls outside of main chamber.

CLOSE/OPEN MAIN DOOR - 1,5, or 10 energy. use different amounts to close different ways. you can just let it drop for 1 energy, 5 energy can close it quickly. and 10 energy can slam it shut extremely hard, great for if something is in the doorway that you want to regret being in the doorway. regardless it takes 5 energy to open it again.

LIGHTS - 5 energy per day, internal lights accelerate plant growth and generally makes it easier to see where you are going and what you are doing

MOVE RIGHT ARM- 5 energy.

MOVE LEFT ARM- 4 energy

WALK- 25 energy per day of solid walking, smooth ride

JOG- 50 energy per day of solid jogging, gentle swaying

RUN- 100 energy per day of solid running, mild shaking

EXTEND/RETRACT STAIRS- 10 energy, control the staircase leading from the live dome hatch to the ground.

SHUT DOWN- turn off active equipment to charge power

EXTERNAL SENSORS- 5 energy per day. power up the eyes to see the world around you.

HOLOGRAPHIC COMMUNICATION SYSTEM- 5 energy to charge and activate and 5 energy a day to keep on, is an extension of the internal lighting system so that must be on as well. allows you to holographicly display anything you wish to the inhabitants of the live dome, holograms are incorporeal.

OBJECT GROWTH SYSTEM - X energy, grow anything you can imagine from pure uranite, complex machines can be done so long as it is one material. power refence would be.... 10 energy to grow a slab that is used as a house foundation. you can also 'find and replace' any already made building. upgrade allows system to build from other materials if they are on hand.

>>748245
How far is it? Also, now that we have a choice as to what method of locomotion we use, what is the most efficient for distance traveled? If we don't have enough energy to reach it we'll need to either shut down for a while longer to regenerate energy or (if the distance is great) find some more souls to raise the rate of regeneration. I was hoping for solar panels or wind power or even a nuclear reactor maybe but it seems that the best we can do right now is lightning rods? The whole city is like a lightning rod so it's not like we'd even have to build something for that.

Open communication with the residents, tell them about the new route and how long it will take without any added energy sources.

Is it possible for us to get unfriendly souls to generate power from? Or would they cause trouble? Could we purposefully turn unfriendly souls into husks?

How electrically conductive is the city's structure, and the stairs? If "not very," let's extrude a hair-thin superconductive wire from the power converter to the highest point on the outer hull, and another one from the power converter down to the ground. Make the lightning's job easier.

Notify folks inside to recall the mining team before we walk off. At the current rate, we're not going to be able to spend more than three days out of every ten walking, so let's plan accordingly. Every time we reach an area with notably different geology, take time off to do more digging, and maintain a reserve of energy as a contingency for defense.

Guide 2016/09/21(Wed)20:06 No. 748987 ID: 3663d3
File 147451357471.png - (33.66KB , 840x482 , map section.png )

>>748248
>>748390
building separate infrastructure is unneeded. while my direct access to energy is limited, when i am sure it would result in a quick return of more energy then was used i am allowed more. in this case a good lightning strike would more then make up for the energy needed to cause a micro strand of uranite to take on superconducting properties for a moment. which i can do.

interesting. but for now.

>>748390
you call back the people as you will be moving again.

>>748248
power to distance ratio has several factors. at this time walking is the most efficient due to the extremely rugged terrain. on flat land running would be the most efficient.

you have also gotten a small amount of map data from the satellite , due to it focusing on your and the ship's areas. the arrow shows our current path so far, roughly 10 hours of walking

>>748987
Looks like it'd take around 40 walk-hours to get there, which would use up almost exactly as much energy as we have or more, unless running is very efficient.

If we had the Atomic Controller running could we make a power plant that would contribute energy if it were provided with fuel? Though, at the moment, I can't think of any sufficiently energetic fuel that we could gather. Or, could we just MAKE fuel? Like could the Atomic Controller let us produce enriched uranium or whatever to run a nuclear reactor? Could we even make a nuclear reactor or does the city not have blueprints for such a thing? Well, that's probably impossible. The city could not possibly create an infinite energy loop like that or it'd be standard equipment.

>>748987
Do we know what kind of terrain is in that brown area on the other side of the mountains?

1/2 Guide 2016/09/27(Tue)15:25 No. 750105 ID: 3663d3
File 147501514297.png - (22.67KB , 600x600 , mapdirect2.png )

>>748988
the atomic controller assists in moving things around at atomic level precision, the ability to build atoms requires quark level precision. but if raw uranium ore is found the controller can process it into a more usable form quite easily

>>748990
it's grassland
then shouldn't it be green?
yes, i can only confirm it's grassland due to annotations, if you look at the area we came from it's just orange, no sign of the various bushes, the map is very simple and basic due to TER-873 not having been requested to update it in.... a while, so it only took a snapshot.

2/2 Guide 2016/09/27(Tue)15:28 No. 750106 ID: 3663d3
File 147501532824.png - (23.67KB , 1247x805 , random encounter.png )

BWAAAH!

i turned the corner of one of the peaks and i found an enemy! they must have been combing the mountains for us, lucked out and weren't found until just now.

should we kill it? will gain souls but the MPM will definitely activate if the souls it has are anything like the last batch (no offense).

>>750106
Yes, kill it. We're gonna need the extra soul power, and we can just close the door until MPM is finished. Should be simpler now that we have better use of limbs. Soul net then squash.

>>750108
Agreement. As an addendum, assuming combat goes according to plan, consider sending people out afterward in rotating shifts to tear apart the thing's body with those new tools. Might be valuable materials in there somewhere, and it'll definitely be good for morale.

1/3 Guide 2016/09/29(Thu)20:17 No. 750352 ID: 3663d3
File 147520545310.png - (43.98KB , 1080x810 , smush.png )

ah, it's trying to run away! not on my watch!

*SMUsoul net deployedSH*

2/3 Guide 2016/09/29(Thu)20:20 No. 750353 ID: 3663d3
File 147520564618.png - (85.36KB , 1155x940 , moresouls.png )

9 compatible souls in net, 4 have formed two separate stable rings, the other 5 are solitary.

let's change the data format so it's easier to tell how many we have of each style.

3/3 Guide 2016/09/29(Thu)20:22 No. 750354 ID: 3663d3
File 147520573819.png - (23.38KB , 1121x930 , coresmap2.png )

and now we need to decided where to put the enemy soul. uppers improve armor efficiency, lower for the legs. and while the left arm has one already it can fit more, just an FYI.

>>750354
>armor efficiency
Did you mean arm efficiency? Also the arm upgrade just let us increase power output on the arm, it's not really more efficient.

Put one on a leg to see what we get out of that. The left leg.

Tell the souls that are freaking out that everything is fine and you are here to welcome them to the afterlife. Focus on the stable rings first and foremost.

>>750355
yes, i meant arm, and no i mean efficiency. it lowers the minimum amount of energy needed to move the arm. left arm takes 4 and right arm takes 5. this allows finer motor control as it's not moving full power for every action.

>>750367
Oh, I had the two mixed up in my head. I guess I still want to use it on the leg though.

You're going to be moving around a lot, put it in the leg. Cheaper movement!

and by "left leg" I mean the side opposite the arm we've upgraded.

1/3 Guide 2016/10/03(Mon)01:49 No. 750904 ID: 3663d3
File 147548459125.png - (59.22KB , 1476x1345 , socket.png )

socketed, running diagnostic... 100% compatibility confirmed again, leg has gotten mild plating near the socket, similar to plate appearing on left arm.

and the souls that have made stable rings seem to be all doing fine. the singles are still having problems though.